|
|
|
|
|
|
|
| Information on 1nyk_A_57 |
|
Loop code: 1nyk_A_57 PDB: 1nyk Chain: A Type: HA beta-beta hairpin |
Loop Start: 57 Loop Length: 21 Sec Struct Nt length: 4 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | ILVYAQGGGEPKPIRLEELKPGDPFVLAYPM |
| Sec Struct: | EEEE--SSSS--B-BGGG--TTS--EEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MGMAGNESIUM ION | E - 73 | 0 | 1 |
| MGMAGNESIUM ION | E - 74 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|