|
|
|
|
|
|
|
| Information on 1p6w_A_202 |
|
Loop code: 1p6w_A_202 PDB: 1p6w Chain: A Type: EH beta-alpha |
Loop Start: 202 Loop Length: 18 Sec Struct Nt length: 3 Sec Struct Ct length: 14 Structure geometry
|
| Sequence: | AVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKV |
| Sec Struct: | EEE-------B-TTSSB-S--HHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CACALCIUM ION | E - 205 | 0 | 1 |
| GLCGLUCOSE | Q - 227 | 1 | 0 |
| GSD4-THIO-D-GLUCOSE | Q - 227 | 1 | 0 |
| GLCGLUCOSE | V - 230 | 1 | 0 |
| GSD4-THIO-D-GLUCOSE | V - 230 | 1 | 0 |
| GLCGLUCOSE | N - 231 | 1 | 0 |
| GSD4-THIO-D-GLUCOSE | N - 231 | 1 | 0 |
| GLCGLUCOSE | D - 234 | 1 | 0 |
| GSD4-THIO-D-GLUCOSE | D - 234 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|