|
|
|
|
|
|
|
| Information on 2por_*_128 |
|
Loop code: 2por_*_128 PDB: 2por Chain: * Type: HA beta-beta hairpin |
Loop Start: 128 Loop Length: 13 Sec Struct Nt length: 7 Sec Struct Ct length: 11 Structure geometry
|
| Sequence: | FSVAASMSDGKVGETSEDDAQEMAVAAAYTF |
| Sec Struct: | EEEEEEE--SBSTTSS-B--EEEEEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CACALCIUM ION | D - 136 | 0 | 1 |
| CACALCIUM ION | G - 137 | 0 | 1 |
| CACALCIUM ION | K - 138 | 0 | 1 |
| CACALCIUM ION | V - 139 | 0 | 1 |
| CACALCIUM ION | G - 140 | 0 | 1 |
| CACALCIUM ION | E - 141 | 0 | 1 |
| CACALCIUM ION | T - 142 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|