|
|
|
|
|
|
|
| Information on 1tn3_*_90 |
|
Loop code: 1tn3_*_90 PDB: 1tn3 Chain: * Type: HE alpha-beta |
Loop Start: 90 Loop Length: 5 Sec Struct Nt length: 14 Sec Struct Ct length: 11 Structure geometry
|
| Sequence: | GSENDALYEYLRQSVGNEAEIWLGLNDMAA |
| Sec Struct: | HHHHHHHHHHHHHHT-TT-EEEEEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CACALCIUM ION | D - 116 | 1 | 0 |
| EOHETHANOL | D - 116 | 1 | 0 |
| CACALCIUM ION | M - 117 | 1 | 0 |
| EOHETHANOL | M - 117 | 1 | 0 |
| EOHETHANOL | A - 118 | 1 | 0 |
| EOHETHANOL | A - 119 | 1 | 0 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| CA1 - CALCIUM BINDING SITE 1. | D - 116 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|