|
|
|
|
|
|
|
| Information on 1q8c_A_14 |
|
Loop code: 1q8c_A_14 PDB: 1q8c Chain: A Type: HH alpha-alpha |
Loop Start: 14 Loop Length: 7 Sec Struct Nt length: 15 Sec Struct Ct length: 10 Structure geometry
|
| Sequence: | RTQRRIAVVEFIFSLLFFLPKEAEVIQADFLE |
| Sec Struct: | HHHHHHHHHHHHHHHGGG----HHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| IODIODIDE ION | R - 14 | 1 | 0 |
| IODIODIDE ION | R - 17 | 1 | 0 |
| IODIODIDE ION | L - 32 | 0 | 1 |
| IODIODIDE ION | P - 33 | 0 | 1 |
| IODIODIDE ION | K - 34 | 0 | 1 |
| Associated ArchDB40 Subclass to 1q8c_A_14 |
| Associated ArchDB95 Subclass to 1q8c_A_14 |
| For any comment or web-related incidence, send an email to the webmaster. |
|