Logo
Information on SUBCLASS 11.8.1
Subclass Accession number: 4277
Subclass: 11.8.1 PSSM
Type: AR beta-beta link
DB: ArchDB95

Image coordinates: Rasmol PDB Jmol PDB
Consensus coordinates: Rasmol PDB Jmol PDB

Conserved Annotation
EC : 1.1 (>75 %)  1.1.99 (>75 %)  1.1.99.86.3 (>50 %)  6.3.4 (>50 %)  6.3.4.4
GO : GO:0000166 (>75 %)  GO:0000287 (>50 %)  GO:0004019 (>75 %)  GO:0005525 (>75 %)  GO:0016614 (>75 %)  GO:0016874 (>75 %)  GO:0016879 (>75 %)  GO:0017076 (>75 %)  GO:0018468 (>75 %)  GO:0019001 (>75 %)  
SCOP : 50997 (>75 %)  50998 (>75 %)  50999 (>75 %)  52539 (>75 %)  52540 (>75 %)  52652 (>75 %)  
 Number of loops: 3

Average sequence ID (%) : 40.0 +/- 13.2
Average RMSD (Å) : 0.367 +/- 0.058

Consensus geometry
d (Å): 15 delta (°): 45-90 theta (°): 0-45 rho (°): 225-270
Consensus Sequence: XhHLhPXGhhppcXX
(φψ)-conformation: bbaappaaaapaabb
Pattern: [EK][TY][ADV][FL][H][L][IL][P][CS][G][IV][IL][NRY][DET][KN][ANV][ITV][S][FIV][IL]
Conservation:-0.019-0.319-1.371-0.3752.4760.439-0.0371.967-0.3921.4580.199-0.045-1.032-0.692-0.071-1.371-0.6360.439-0.579-0.041
Loops included in this Subclass
LoopPDBChainStartEndSequenceSec StructRamachandran
1iwe_A_791iwe   A7998EYDFHLLPSGIINTKAVSFIEEEESSS-GGGG-TTSEEEEbbbbaaxxaaaaxaabxxbb
1p9b_A_611p9b   A6281KYALHLLPCGVLYDNNISVLEEEESSS-TTTTSTT-EEEExbbbaaxxaaaabaaxbxbb
1qf5_A_481qf5   A4968KTVLHLIPSGILRENVTSIIEEEESSS-TTTT-TT-EEEEbbbxaaxpaaaaxaabbxbb
PDB ligands within a cut-off distance of 6 Å in this subclass
LoopPDBChainLigandsResidue
1p9b_A_611p9b   A     GDPGUANOSINE-5'-DIPHOSPHATE K - 62
1qf5_A_481qf5   A     GDPGUANOSINE-5'-DIPHOSPHATE K - 49
1qf5_A_481qf5   A     RPL(C8-S)-HYDANTOCIDIN 5'-PHOSPHATE H - 53

Clusters included in this Subclass
CLUSTER: AR.11.29