Information on SUBCLASS 1.2.39 |
Subclass Accession number: 2117
Subclass: 1.2.39 ![]() Type: HH alpha-alpha DB: ArchDB40 Image coordinates: ![]() ![]() Consensus coordinates: ![]() ![]() Conserved Annotation EC : - (>75 %) 1 (>75 %) 2 (>75 %) 3 (>75 %) GO : GO:0008415 (>75 %) GO:0016746 (>75 %) GO:0016747 (>75 %) SCOP : 53473 (>75 %) 53474 (>75 %) 53491 (>75 %) |
Number of loops: 2 Average sequence ID (%) : 10.0 +/- 0.0 Average RMSD (Å) : 0.900 +/- 0.000 Consensus geometry
|
Consensus Sequence: | PYpXX |
(φψ)-conformation: | aabaa |
Pattern: | [A] | x | [AV] | [AL] | [ER] | [IK] | [FL] | [AR] | [P] | [Y] | [DH] | [EP] | x | [VY] | [AE] | [EN] | [IK] | [CL] | [HI] | [NY] | [AR] | [AQ] | [KL] | [GV] | [KS] | [LY] | [EQ] | x | [LT] | [KY] |
Conservation: | 1.131 | -0.717 | -0.213 | -0.549 | 0.123 | -1.053 | 0.123 | -0.381 | 3.147 | 3.147 | 0.459 | 0.123 | -1.053 | -0.045 | -0.381 | 0.291 | -1.053 | 0.291 | -0.549 | -0.045 | -0.381 | -0.381 | -0.717 | -0.885 | -0.045 | -0.045 | 0.795 | -0.549 | -0.381 | -0.213 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1clc_*_296 | 1clc | - | 307 | 336 | AMAARIFRPYDPQYAEKCINAAKVSYEFLK | HHHHHHHTTT-HHHHHHHHHHHHHHHHHHH | aaaaaaaaaabaaaaaaaaaaaaaaaaaaa |
1nk4_A_558 | 1nk4 | A | 558 | 587 | ADVLEKLAPYHEIVENILHYRQLGKLQSTY | HHHHHHHGGG-HHHHHHHHHHHHHHHHHHH | aaaaaaaaaabaaaaaaaaaaaaaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Loop | PDB | Chain | Ligands | Residue |
1clc_*_296 | 1clc | * | CACALCIUM ION | A - 297 |
Clusters included in this Subclass |
CLUSTER: HH.4.124 |