Information on SUBCLASS 3.23.1 |
Subclass Accession number: 2360
Subclass: 3.23.1 Type: HH alpha-alpha DB: ArchDB40 Image coordinates: Consensus coordinates: Conserved Annotation EC : 1.11 (>75 %) 1.11.1 (>75 %) 1.11.1.14 GO : GO:0004601 (>75 %) GO:0005344 (>75 %) GO:0005509 (>75 %) GO:0016684 (>75 %) GO:0016690 (>50 %) SCOP : 46457 (>75 %) 46458 (>75 %) 46463 (>75 %) 48112 (>75 %) 48113 (>75 %) 48114 (>75 %) |
Number of loops: 2 Average sequence ID (%) : 45.7 +/- 0.0 Average RMSD (Å) : 0.300 +/- 0.000 Consensus geometry
|
Consensus Sequence: | SXGVXXX |
(φψ)-conformation: | aalpbaa |
Pattern: | [A] | [TV] | [L] | [K] | [N] | [IL] | [AG] | [NS] | [KV] | [H] | [AV] | [S] | [KL] | [G] | [V] | [AK] | [DP] | [AE] | [HQ] | [FY] | [P] | [IV] | [V] | [GK] | [E] | x | [IL] | [L] | [AK] | [AT] | [I] | [K] | [E] | [V] | [LV] |
Conservation: | 0.258 | -0.813 | 0.258 | 0.870 | 1.482 | -0.354 | -0.660 | -0.354 | -1.426 | 2.707 | -0.966 | 0.258 | -1.426 | 1.482 | 0.258 | -1.119 | -0.507 | -1.119 | -0.201 | 0.717 | 2.095 | -0.048 | 0.258 | -1.119 | 0.870 | -0.966 | -0.354 | 0.258 | -1.119 | -0.813 | 0.258 | 0.870 | 0.870 | 0.258 | -0.660 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1cqx_A_71 | 1cqx | A | 76 | 110 | AVLKNIANKHASLGVKPEQYPIVGEHLLAAIKEVL | HHHHHHHHHHHHHT--GGGHHHHHHHHHHHHHHHH | aaaaaaaaaaaaavxbaaaaaaaaaaaaaaaaaaa |
2gdm_*_88 | 2gdm | - | 88 | 122 | ATLKNLGSVHVSKGVADAHFPVVKEAILKTIKEVV | HHHHHHHHHHHHTT--GGGHHHHHHHHHHHHHHHH | aaaaaaaaaaaaavxbaaaaaaaaaaaaaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Clusters included in this Subclass |
CLUSTER: HH.6.57 |