Information on SUBCLASS 8.4.1 |
Subclass Accession number: 2525
Subclass: 8.4.1 Type: HH alpha-alpha DB: ArchDB40 Image coordinates: Consensus coordinates: Conserved Annotation EC : 2.5 (>75 %) 2.5.1 (>75 %) 2.5.1.18 (>75 %) 2.7.3 (>75 %) 2.7.3.2 (>75 %) 3.2 (>75 %) 3.2.1 (>75 %) 3.2.1.8 GO : GO:0004111 (>75 %) GO:0004364 (>75 %) GO:0004553 (>75 %) GO:0016301 (>75 %) GO:0016765 (>75 %) GO:0016775 (>75 %) GO:0016798 (>75 %) SCOP : 47615 (>75 %) 47616 (>75 %) 47617 (>75 %) 48033 (>75 %) 48034 (>75 %) 48035 (>75 %) 51350 (>75 %) 51445 (>75 %) 51487 (>75 %) |
Number of loops: 6 Average sequence ID (%) : 29.3 +/- 21.6 Average RMSD (Å) : 0.417 +/- 0.075 Consensus geometry
|
Consensus Sequence: | XhpPXhLcXhPX |
(φψ)-conformation: | aabaaaaaabaa |
Pattern: | [fhlwy] | [APV] | [D] | [FILY] | [hlmy] | [ACLW] | [lvy] | x | [ACIL] | [l] | [dety] | [itvy] | [lpvy] | x | x | [FHLM] | [ADEKT] | [PS] | [degks] | [CL] | [IL] | [DKS] | [ADNS] | [cf] | [P] | x | [IL] | [kv] | [ACDT] | [FLY] | x | [AKT] | [KR] | [FILV] | [AEQS] |
Conservation: | -0.677 | -0.091 | 2.683 | 0.316 | -0.520 | -0.640 | -0.515 | -0.535 | -0.404 | 0.140 | -1.067 | -0.733 | -0.989 | -0.862 | -0.881 | -0.329 | -0.554 | 1.477 | -0.916 | 0.612 | 1.024 | 0.365 | -0.315 | 0.083 | 3.297 | -0.680 | 1.021 | -0.631 | -0.508 | 0.220 | -0.582 | -0.252 | 1.412 | 0.206 | -0.178 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1dug_A_149 | 1dug | A | 149 | 183 | HPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIE | HHHHHHHHHHHHHHHH-TTTTTT-HHHHHHHHHHH | aaaaaaaaaaaaaaaabaaaaaabaaaaaaaaaaa |
1glq_A_150 | 1glq | A | 150 | 184 | FADYNLLDLLLIHQVLAPGCLDNFPLLSAYVARLS | HHHHHHHHHHHHHHHHSTTTTTT-HHHHHHHHHHH | aaaaaaaaaaaaaaaabaaaaaabaaaaaaaaaaa |
1iyh_A_148 | 1iyh | A | 148 | 182 | WADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQ | HHHHHHHHHHHHHHHH-TTTTTT-HHHHHHHHHHH | aaaaaaaaaaaaaaaabaaaaaabaaaaaaaaaaa |
1k3y_A_155 | 1k3y | A | 155 | 189 | RADIHLVELLYYVEELDSSLISSFPLLKALKTRIS | HHHHHHHHHHHHHHHH-TTTTTT-HHHHHHHHHHH | aaaaaaaaaaaaaaaabaaaaaabaaaaaaaaaaa |
2gsq_*_151 | 2gsq | - | 151 | 185 | LADLHCYVALEVPLKHTPELLKDCPKIVALRKRVA | HHHHHHHHHHHHHHHH-TTTTTT-HHHHHHHHHHH | aaaaaaaaaaaaaaaabaaaaaabaaaaaaaaaaa |
2gst_A_154 | 2gst | A | 154 | 188 | YVDFLAYDILDQYHIFEPKCLDAFPNLKDFLARFE | HHHHHHHHHHHHHHHHSTTTTTT-HHHHHHHHHHH | aaaaaaaaaaaaaaaabaaaaaabaaaaaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Loop | PDB | Chain | Ligands | Residue |
1k3y_A_155 | 1k3y | A | GOLGLYCEROL | R - 155 |
1k3y_A_155 | 1k3y | A | GOLGLYCEROL | H - 159 |
2gst_A_154 | 2gst | A | GPS(9S,10S)-9-(S-GLUTATHIONYL)-10-HYDROXY-9,10-DIHYDROPHENANTHRENE | Q - 165 |
Clusters included in this Subclass |
CLUSTER: HH.7.11 |