Information on SUBCLASS 22.1.1 |
Subclass Accession number: 4334
Subclass: 22.1.1 ![]() Type: AR beta-beta link DB: ArchDB95 Image coordinates: ![]() ![]() Consensus coordinates: ![]() ![]() Conserved Annotation EC : 3.1 (>75 %) 3.1 (>75 %) 3.1.1 (>75 %) 3.1.1 (>75 %) 3.1.1.73.1.1.7 (>75 %) GO : GO:0004091 (>75 %) GO:0004091 (>75 %) GO:0004104 (>75 %) GO:0004104 (>75 %) GO:0016788 (>75 %) GO:0016788 (>75 %) GO:0016789 (>75 %) GO:0016789 (>75 %) SCOP : 53473 (>75 %) 53473 (>75 %) 53474 (>75 %) 53474 (>75 %) 53475 (>75 %) 53475 (>75 %) |
Number of loops: 3 Average sequence ID (%) : 56.2 +/- -1.0 Average RMSD (Å) : 0.267 +/- 0.058 Consensus geometry
|
Consensus Sequence: | IPhApPPhGpXRFXXPpXXpXWSchh |
(φψ)-conformation: | pwabpppbeaaplpppbppppbbebp |
Pattern: | [GS] | [HPT] | [IV] | [ST] | [A] | [F] | [L] | [G] | [I] | [P] | [FY] | [A] | [EQ] | [P] | [P] | [LV] | [G] | [NRS] | x | [R] | [F] | [KMR] | [KPR] | [P] | [EQ] | [PS] | [KL] | [KRT] | [KP] | [W] | [S] | [DG] | [IV] | [LW] | [DN] |
Conservation: | -0.550 | -1.341 | -0.226 | -0.599 | -0.005 | 0.919 | -0.005 | 0.919 | -0.005 | 1.382 | 0.325 | -0.005 | -0.225 | 1.382 | 1.382 | -0.687 | 0.919 | -1.084 | -1.238 | 0.457 | 0.919 | -1.084 | -1.084 | 1.382 | -0.225 | -0.700 | -1.222 | -1.084 | -0.612 | 3.231 | -0.005 | -0.672 | -0.232 | -0.144 | -0.185 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1ea5_A_25 | 1ea5 | A | 25 | 59 | SHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWN | EEEEEEEEEE-B----GGGTTS---B----SSEEE | bbbxbbbvxwabxpxbeaapvxxxbpxxpbxebxx |
1n5m_A_27 | 1n5m | A | 27 | 61 | GPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLD | EEEEEEEEEE-B----GGGTTS---B----SSEEE | exbxbbbvxwabxpabeaapvxpxbpxxpbbexxx |
1p0i_A_23 | 1p0i | A | 23 | 57 | GTVTAFLGIPYAQPPLGRLRFKKPQSLTKWSDIWN | EEEEEEEEEE-S----GGGTTS---------SEEE | bbbbbbbvxxabxpxbeaaxvxxwbxxxpbbebxx |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Loop | PDB | Chain | Ligands | Residue |
1ea5_A_25 | 1ea5 | A | NAGN-ACETYL-D-GLUCOSAMINE | N - 59 |
1n5m_A_27 | 1n5m | A | IODIODIDE ION | G - 27 |
1n5m_A_27 | 1n5m | A | IODIODIDE ION | P - 28 |
1p0i_A_23 | 1p0i | A | GOLGLYCEROL | A - 27 |
1p0i_A_23 | 1p0i | A | GOLGLYCEROL | L - 29 |
1p0i_A_23 | 1p0i | A | NAGN-ACETYL-D-GLUCOSAMINE | D - 54 |
1p0i_A_23 | 1p0i | A | NAGN-ACETYL-D-GLUCOSAMINE | I - 55 |
1p0i_A_23 | 1p0i | A | NAGN-ACETYL-D-GLUCOSAMINE | W - 56 |
1p0i_A_23 | 1p0i | A | NAGN-ACETYL-D-GLUCOSAMINE | N - 57 |
Clusters included in this Subclass |
CLUSTER: AR.22.1 |