Information on SUBCLASS 9.27.1 |
Subclass Accession number: 5095
Subclass: 9.27.1 Type: HH alpha-alpha DB: ArchDB95 Image coordinates: Consensus coordinates: Conserved Annotation SCOP : 56573 (>75 %) 56574 (>75 %) 56575 (>75 %) |
Number of loops: 3 Average sequence ID (%) : 52.1 +/- 2.9 Average RMSD (Å) : 0.400 +/- 0.000 Consensus geometry
|
Consensus Sequence: | XXXPpXNhhhSPh |
(φψ)-conformation: | aabaappbbbbaa |
Pattern: | [F] | [AT] | [FV] | [DS] | [L] | [FY] | [KR] | [AQ] | [L] | [ANV] | x | [AKS] | [AD] | [P] | [DST] | [GKQ] | [N] | [IV] | [FI] | [FI] | [S] | [P] | [LV] | [S] | [I] | [S] | x | [AS] | [L] | [A] | [FM] | [IL] |
Conservation: | 1.623 | -0.575 | -0.538 | -0.268 | 0.452 | 0.987 | 0.189 | -0.865 | 0.452 | -1.631 | -1.696 | -1.045 | -1.049 | 2.209 | -0.915 | -1.240 | 1.623 | 0.169 | -0.268 | -0.256 | 0.452 | 2.209 | -0.386 | 0.452 | 0.452 | 0.452 | -1.110 | -0.386 | 0.452 | 0.452 | -0.280 | -0.112 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1as4_A_26 | 1as4 | A | 33 | 64 | FAFSLYKQLVLKAPDKNVIFSPLSISTALAFL | HHHHHHHHHHHH-TTS-----HHHHHHHHHHH | aaaaaaaaaaaabaaxxbbbbaaaaaaaaaaa |
1hle_A_24 | 1hle | A | 33 | 64 | FAVDLFRALNESDPTGNIFISPLSISSALAMI | HHHHHHHHHHHH-SSS-----HHHHHHHHHHH | aaaaaaaaaaaabaaxxbbbbaaaaaaaaaaa |
1lq8_A_29 | 1lq8 | A | 29 | 60 | FTFDLYRALASAAPSQNIFFSPVSISMSLAML | HHHHHHHHHHHHSTTS-----HHHHHHHHHHH | aaaaaaaaaaaabaabxbbbbaaaaaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Loop | PDB | Chain | Ligands | Residue |
1as4_A_26 | 1as4 | A | ACTACETATE ION | V - 50 |
1as4_A_26 | 1as4 | A | ACTACETATE ION | I - 51 |
1as4_A_26 | 1as4 | A | ACTACETATE ION | F - 52 |
Clusters included in this Subclass |
CLUSTER: HH.8.75 |