Information on SUBCLASS 14.1.1 |
Subclass Accession number: 6016
Subclass: 14.1.1 Type: HE alpha-beta DB: ArchDB95 Image coordinates: Consensus coordinates: Conserved Annotation EC : 1.11 (>50 %) 1.11.1 (>50 %) 1.11.1.5 GO : GO:0004130 (>50 %) GO:0004601 (>75 %) GO:0016684 (>75 %) SCOP : 46625 (>75 %) 46626 (>75 %) 46685 (>75 %) |
Number of loops: 3 Average sequence ID (%) : 47.8 +/- 8.1 Average RMSD (Å) : 0.233 +/- 0.058 Consensus geometry
|
Consensus Sequence: | cpGCXXCHpGhXhGGpXY |
(φψ)-conformation: | aagaaaabbeaalelabb |
Pattern: | [AEQ] | [DQS] | [EQ] | [KL] | [EK] | [G] | [LY] | [AKN] | [AL] | [F] | [KM] | [DG] | [RS] | [G] | [C] | [STV] | [AQ] | [C] | [H] | [NS] | [G] | [IPV] | [AN] | [LV] | [G] | [G] | [QS] | [ANS] | [Y] | [FQY] |
Conservation: | -0.826 | -0.782 | -0.024 | -0.875 | -0.212 | 0.937 | -0.615 | -1.046 | -0.796 | 0.937 | -0.614 | -0.410 | -0.734 | 0.937 | 2.127 | -0.958 | -0.751 | 2.127 | 1.730 | -0.113 | 0.937 | -0.958 | -0.739 | -0.434 | 0.937 | 0.937 | -0.490 | -0.826 | 1.334 | -0.738 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1eb7_A_183 | 1eb7 | A | 183 | 212 | AQQKKGLKAFMDSGCSACHNGINLGGQAYF | HHHHHHHHHHHHTTGGGTS-BTTTS-S-EE | aaaaaaaaaaaaavaaaaxbeaalevabbb |
1iqc_A_169 | 1iqc | A | 169 | 198 | QDELEGYNLFKGSGCVQCHNGPAVGGSSYQ | HHHHHHHHHHHHHTGGGTS-TTTTS-SSEE | aaaaaaaaaaaaagaaaabbeaalevabbb |
1nml_A_183 | 1nml | A | 183 | 212 | ESEKEGLALFMDRGCTACHSGVNLGGQNYY | HHHHHHHHHHHHTTGGGTS-BTTTS-S-EE | aaaaaaaaaaaaavaaaabbeaalevabbb |
PDB ligands within a cut-off distance of 6 Å in this subclass |
PDB Site Annotated loops in this subclass |
Clusters included in this Subclass |
CLUSTER: HE.15.7 |