Information on SUBCLASS 14.3.1 |
Subclass Accession number: 6018
Subclass: 14.3.1 ![]() Type: HE alpha-beta DB: ArchDB95 Image coordinates: ![]() ![]() Consensus coordinates: ![]() ![]() Conserved Annotation GO : GO:0005489 (>75 %) SCOP : 48694 (>75 %) 48695 (>75 %) 48696 (>75 %) |
Number of loops: 2 Average sequence ID (%) : 59.4 +/- 0.0 Average RMSD (Å) : 0.500 +/- 0.000 Consensus geometry
|
Consensus Sequence: | LXpXXVXPhphMXhPYKV |
(φψ)-conformation: | aapbppppppaaabpabb |
Pattern: | [P] | [DG] | [DQ] | [N] | [E] | [A] | [L] | [A] | [A] | [E] | [T] | [V] | [L] | [AN] | [EH] | [AK] | [PT] | [V] | [AQ] | [P] | [LV] | [ST] | [AP] | [M] | x | [AG] | [P] | [Y] | [K] | [V] | [SV] | [I] |
Conservation: | 1.818 | -0.780 | -0.636 | 1.241 | 0.663 | 0.086 | 0.086 | 0.086 | 0.086 | 0.663 | 0.663 | 0.086 | 0.086 | -1.358 | -0.347 | -1.213 | -0.780 | 0.086 | -1.213 | 1.818 | -0.780 | -0.636 | -0.925 | 0.663 | -1.502 | -0.780 | 1.818 | 1.818 | 0.663 | 0.086 | -1.647 | 0.086 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
19hc_A_152 | 19hc | A | 152 | 183 | PGDNEALAAETVLAEATVAPVSPMLAPYKVVI | HHHHHHHHHHHHHH--------GGGS-S-EEE | aaaaaaaaaaaaaaxbxxxxpxaaabpabbxx |
1duw_A_152 | 1duw | A | 152 | 183 | PDQNEALAAETVLNHKPVQPLTAMQGPYKVSI | HHHHHHHHHHHHHH--------GGGS-S-EEE | aaaaaaaaaaaaaaxbpxxxxxaaabxabbxx |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Clusters included in this Subclass |
CLUSTER: HE.15.6 |