Logo
Information on SUBCLASS 7.20.1
Subclass Accession number: 6502
Subclass: 7.20.1 PSSM
Type: HA beta-beta hairpin
DB: ArchDB95

Image coordinates: Rasmol PDB Jmol PDB
Consensus coordinates: Rasmol PDB Jmol PDB

Conserved Annotation
GO : GO:0003723 (>50 %)  
SCOP : 53334 (>50 %)  53335 (>50 %)  53342 (>50 %)  
Number of loops: 3

Average sequence ID (%) : 28.1 +/- 18.7
Average RMSD (Å) : 1.200 +/- 0.520

Consensus geometry
d (Å): 7 delta (°): 45-90 theta (°): 135-180 rho (°): 270-315
Consensus Sequence: hcXpPhXXcHh
(φψ)-conformation: bpapwabplbb
Pattern: x[FIV][ADE]x[LV][DN]x[EK][P][FVY]x[KP][DG][H][AV][LM][FV][CV][GPV]
Conservation:-0.763-0.309-0.593-1.1030.0120.566-0.9330.2562.243-0.252-0.544-0.0760.0422.754-0.2220.309-0.109-0.119-1.160
Loops included in this Subclass
LoopPDBChainStartEndSequenceSec StructRamachandran
1fit_*_221fit   -2240SFALVNRKPVVPGHVLVCPEEEEE-SS-SSTT-EEEEEbbbbxxabxabxvxbbbbx
1g8a_A_2051g8a   A206224VIERLNLEPYEKDHALFVVEEEEEE-TTTSSSEEEEEExabbbxaxwabblbbbbbb
1g8s_A_2051g8s   A207225IVDEVDIEPFEKDHVMFVGEEEEEE-TTTSTTEEEEEExabbbxaxwabxlbbxbbb
PDB ligands within a cut-off distance of 6 Å in this subclass
LoopPDBChainLigandsResidue
1fit_*_221fit   *     MSESELENOMETHIONINE V - 26
1fit_*_221fit   *     MSESELENOMETHIONINE N - 27
1fit_*_221fit   *     MSESELENOMETHIONINE R - 28
1fit_*_221fit   *     FRUFRUCTOSE P - 33

Clusters included in this Subclass
CLUSTER: HA.8.89