Logo
Information on SUBCLASS 5.3.6
Subclass Accession number: 715
Subclass: 5.3.6 PSSM
Type: HA beta-beta hairpin
DB: ArchDB40

Image coordinates: Rasmol PDB Jmol PDB
Consensus coordinates: Rasmol PDB Jmol PDB

Conserved Annotation
EC : 3.4 (>50 %)  3.4.17 (>50 %)  
GO : GO:0004180 (>50 %)  GO:0008233 (>50 %)  GO:0008235 (>50 %)  GO:0008237 (>50 %)  GO:0008238 (>50 %)  
SCOP : 53162 (>50 %)  53187 (>50 %)  
 Number of loops: 3

Average sequence ID (%) : 30.0 +/- 20.7
Average RMSD (Å) : 0.933 +/- 0.416

Consensus geometry
d (Å): 3 delta (°): 135-180 theta (°): 135-180 rho (°): 315-360
Consensus Sequence: GppppGXXh
(φψ)-conformation: ebpaalpbb
Pattern: [V]x[FK][FLT]xx[G][KRT][ST][DY][ES][G]x[EP][FIL][GWY][AV]x[FK][FIK]
Conservation:1.189-1.007-0.515-0.724-0.511-0.6432.464-0.2990.373-0.0510.2002.464-0.4110.230-0.086-0.0860.015-0.936-0.515-1.149
Loops included in this Subclass
LoopPDBChainStartEndSequenceSec StructRamachandran
1m4l_A_331m4l   A3352VSKLQIGRSYEGRPIYVLKFEEEEEEEE-TTS-EEEEEEEbbbbbaebxaavxxbbbxbb
1obr_*_301obr   -3049VKKFSIGKSYEGRELWAVKIEEEEEEEE-TTS-EEEEEEEbbxbbaebxaavxxxxbbbb
2por_*_192por   -2746VLFTMSGTTDSGLEFGASFKEEEEEEEE-TT--EEEEEEEbbxbbbbbxaavxbbbbbbx
PDB ligands within a cut-off distance of 6 Å in this subclass
LoopPDBChainLigandsResidue
1obr_*_301obr   *     CACALCIUM ION K - 48
2por_*_192por   *     OTE2-{2-[2-(2-OCTYLOXY-ETHOXY)-ETHOXYL]-ETHOXY}ETHANOL W - 19
2por_*_192por   *     OTE2-{2-[2-(2-OCTYLOXY-ETHOXY)-ETHOXYL]-ETHOXY}ETHANOL N - 20
2por_*_192por   *     OTE2-{2-[2-(2-OCTYLOXY-ETHOXY)-ETHOXYL]-ETHOXY}ETHANOL F - 21

Clusters included in this Subclass
CLUSTER: HA.6.95