|
|
|
|
|
|
|
| Information on CLUSTER HH.3.144 |
Subclass Accession number: HH-4.8.3
DB: ArchDB-EC
| Loops included in this Cluster |
| Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
| 1j8u_A_297 | 1j8u | A | 297 | 326 | RSFAQFSQEIGLASLGAPDEYIEKLATIYW | HHHHHHHHHHHHHHTT--HHHHHHHHHHHH | aaaaaaaaaaaaaaxvxxaaaaaaaaaaaa |
| 1mlw_A_284 | 1mlw | A | 284 | 313 | PSFAQFSQEIGLASLGASEEAVQKLATCYF | HHHHHHHHHHHHHHTT--HHHHHHHHHHHH | aaaaaaaaaaaaaaxvxxaaaaaaaaaaaa |
| 1toh_*_343 | 1toh | - | 343 | 372 | RTFAQFSQDIGLASLGASDEEIEKLSTVYW | HHHHHHHHHHHHHHTT--HHHHHHHHHHHH | aaaaaaaaaaaaaapvxxaaaaaaaaaaaa |
| For any comment or web-related incidence, send an email to the webmaster. |
|