|
|
|
|
|
|
|
| Information on CLUSTER HH.3.250 |
Subclass Accession number: HH-4.18.2
DB: ArchDB95
| Loops included in this Cluster |
| Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
| 1kjo_A_281 | 1kjo | A | 281 | 312 | FSQLRAAAVQSATDLYGSTSQEVASVKQAFDA | HHHHHHHHHHHHHHHH-TTSHHHHHHHHHHHH | aaaaaaaaaaaaaaaaeaaxaaaaaaaaaaaa |
| 1npc_*_282 | 1npc | - | 282 | 313 | FSQARAGAVQAAADLYGANSAEVAAVKQSFSA | HHHHHHHHHHHHHHHH-TT-HHHHHHHHHHHH | aaaaaaaaaaaaaaaaeaaxaaaaaaaaaaaa |
| For any comment or web-related incidence, send an email to the webmaster. |
|