|
|
|
|
|
|
|
| Information on 1p9s_A_121 |
|
Loop code: 1p9s_A_121 PDB: 1p9s Chain: A Type: AR beta-beta link |
Loop Start: 121 Loop Length: 19 Sec Struct Nt length: 7 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | AQGVFGVNRTNWTIRGSFINGACGSPGYNLK |
| Sec Struct: | EEEEEEE--TTS-B-----TT-TT--EEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | Q - 122 | 1 | 0 |
| MSESELENOMETHIONINE | G - 123 | 1 | 0 |
| MSESELENOMETHIONINE | V - 124 | 1 | 0 |
| MSESELENOMETHIONINE | F - 125 | 1 | 0 |
| MSESELENOMETHIONINE | G - 126 | 0 | 1 |
| MSESELENOMETHIONINE | V - 127 | 0 | 1 |
| MSESELENOMETHIONINE | N - 128 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|