|
|
|
|
|
|
|
| Information on 1h16_A_25 |
|
Loop code: 1h16_A_25 PDB: 1h16 Chain: A Type: HH alpha-alpha |
Loop Start: 25 Loop Length: 15 Sec Struct Nt length: 8 Sec Struct Ct length: 20 Structure geometry
|
| Sequence: | VRDFIQKNYTPYEGDESFLAGATEATTTLWDKVMEGVKLENRT |
| Sec Struct: | HHHHHHHH-----S-GGG-----HHHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| PG4TETRAETHYLENE GLYCOL | E - 40 | 0 | 1 |
| PG4TETRAETHYLENE GLYCOL | S - 41 | 0 | 1 |
| PG4TETRAETHYLENE GLYCOL | F - 42 | 0 | 1 |
| PG4TETRAETHYLENE GLYCOL | L - 43 | 0 | 1 |
| PG4TETRAETHYLENE GLYCOL | A - 44 | 0 | 1 |
| DTLD-TREITOL | E - 64 | 1 | 0 |
| DTLD-TREITOL | N - 65 | 1 | 0 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| NA6 - NA BINDING SITE FOR CHAIN A | K - 62 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|