|
|
|
|
|
|
|
| Information on 1rdr_*_72 |
|
Loop code: 1rdr_*_72 PDB: 1rdr Chain: * Type: HH alpha-alpha |
Loop Start: 72 Loop Length: 16 Sec Struct Nt length: 15 Sec Struct Ct length: 4 Structure geometry
|
| Sequence: | EYMKEAVDHYAGQLMSLDINTEQMCLNDSVAMRMA |
| Sec Struct: | HHHHHHHHHHHHHHHTT-------------SHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CACALCIUM ION | M - 86 | 0 | 1 |
| CACALCIUM ION | S - 87 | 0 | 1 |
| CACALCIUM ION | L - 88 | 0 | 1 |
| CACALCIUM ION | D - 89 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|