|
|
|
|
|
|
|
| Information on 1pym_A_197 |
|
Loop code: 1pym_A_197 PDB: 1pym Chain: A Type: HH alpha-alpha |
Loop Start: 197 Loop Length: 21 Sec Struct Nt length: 5 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | SDIEAFKAWNNQGPVVIVPTKYYKTPTDHFR |
| Sec Struct: | HHHHH---STT-S-B----SSSTTS-HHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | D - 198 | 1 | 0 |
| MSESELENOMETHIONINE | I - 199 | 1 | 0 |
| MSESELENOMETHIONINE | E - 200 | 0 | 1 |
| MSESELENOMETHIONINE | A - 201 | 0 | 1 |
| MSESELENOMETHIONINE | F - 202 | 0 | 1 |
| MSESELENOMETHIONINE | N - 207 | 0 | 1 |
| MSESELENOMETHIONINE | V - 212 | 0 | 1 |
| MSESELENOMETHIONINE | Y - 219 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|