|
|
|
|
|
|
|
| Information on 1pym_A_224 |
|
Loop code: 1pym_A_224 PDB: 1pym Chain: A Type: HH alpha-alpha |
Loop Start: 224 Loop Length: 9 Sec Struct Nt length: 5 Sec Struct Ct length: 20 Structure geometry
|
| Sequence: | TDHFRDGVSVIWANHNLRASVSAIQQTTKQIYDD |
| Sec Struct: | HHHHH--------SHHHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | D - 225 | 1 | 0 |
| MSESELENOMETHIONINE | H - 226 | 1 | 0 |
| MSESELENOMETHIONINE | F - 227 | 0 | 1 |
| MSESELENOMETHIONINE | R - 228 | 0 | 1 |
| MSESELENOMETHIONINE | D - 229 | 0 | 1 |
| MSESELENOMETHIONINE | N - 239 | 1 | 0 |
| OXLOXALATE ION | N - 239 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|