|
|
|
|
|
|
|
| Information on 1li1_A_189 |
|
Loop code: 1li1_A_189 PDB: 1li1 Chain: A Type: AR beta-beta link |
Loop Start: 189 Loop Length: 28 Sec Struct Nt length: 4 Sec Struct Ct length: 7 Structure geometry
|
| Sequence: | YSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMR |
| Sec Struct: | EEEE-B---GGGTTS--------TTSGGGGB-EEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| ACTACETATE ION | Y - 189 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|