|
|
|
|
|
|
|
| Information on 1r8h_A_293 |
|
Loop code: 1r8h_A_293 PDB: 1r8h Chain: A Type: HE alpha-beta |
Loop Start: 293 Loop Length: 23 Sec Struct Nt length: 14 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | SNCLKCFRYRLNDKHRHLFDLISSTWHWASPKAPHKHAIVTVT |
| Sec Struct: | HHHHHHHHHHHHHH-GGG-S-B---B---STT-S---EEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| PO4PHOSPHATE ION | K - 297 | 1 | 0 |
| PO4PHOSPHATE ION | F - 299 | 1 | 0 |
| PO4PHOSPHATE ION | R - 300 | 1 | 0 |
| PO4PHOSPHATE ION | Y - 301 | 1 | 0 |
| PO4PHOSPHATE ION | R - 302 | 1 | 0 |
| PO4PHOSPHATE ION | L - 303 | 1 | 0 |
| PO4PHOSPHATE ION | S - 315 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|