|
|
|
|
|
|
|
| Information on 1lvo_A_171 |
|
Loop code: 1lvo_A_171 PDB: 1lvo Chain: A Type: EH beta-alpha |
Loop Start: 171 Loop Length: 25 Sec Struct Nt length: 4 Sec Struct Ct length: 13 Structure geometry
|
| Sequence: | HVGSNFEGEMYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALI |
| Sec Struct: | EEEE-TTS-BGGG--SSS---------B-HHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| DOXDIOXANE | Y - 181 | 0 | 1 |
| DOXDIOXANE | G - 182 | 0 | 1 |
| MPD2-METHYL-2,4-PENTANEDIOL | E - 185 | 0 | 1 |
| MPD2-METHYL-2,4-PENTANEDIOL | D - 186 | 0 | 1 |
| MPD2-METHYL-2,4-PENTANEDIOL | Q - 187 | 0 | 1 |
| MPD2-METHYL-2,4-PENTANEDIOL | P - 188 | 0 | 1 |
| MPD2-METHYL-2,4-PENTANEDIOL | S - 189 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|