|
|
|
|
|
|
|
| Information on 1mji_A_101 |
|
Loop code: 1mji_A_101 PDB: 1mji Chain: A Type: HE alpha-beta |
Loop Start: 101 Loop Length: 21 Sec Struct Nt length: 8 Sec Struct Ct length: 4 Structure geometry
|
| Sequence: | IFLEKLLNVALPRIRDFRGLNPNSFDGRGNYNL |
| Sec Struct: | HHHHHHHHTTTTT-SS---B-TT-B-SSSEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | I - 101 | 1 | 0 |
| MSESELENOMETHIONINE | F - 102 | 1 | 0 |
| MSESELENOMETHIONINE | L - 103 | 1 | 0 |
| MSESELENOMETHIONINE | E - 104 | 1 | 0 |
| MGMAGNESIUM ION | R - 128 | 0 | 1 |
| MGMAGNESIUM ION | G - 129 | 0 | 1 |
| MGMAGNESIUM ION | N - 130 | 0 | 1 |
| MSESELENOMETHIONINE | L - 133 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|