Information on SUBCLASS 19.1.1 |
Subclass Accession number: 8778
Subclass: 19.1.1 Type: HE alpha-beta DB: ArchDB-EC Image coordinates: Consensus coordinates: Conserved Annotation EC : 1.11 (>75 %) 1.11.1 (>75 %) 1.11.1.6 GO : GO:0004096 (>75 %) GO:0004601 (>75 %) GO:0016684 (>75 %) SCOP : 56633 (>75 %) 56634 (>75 %) 56635 (>75 %) |
Number of loops: 3 Average sequence ID (%) : 52.5 +/- 3.3 Average RMSD (Å) : 0.533 +/- 0.153 Consensus geometry
|
Consensus Sequence: | pphXFphFDLTKXhXpcphPXXX |
(φψ)-conformation: | aapabpaapaabbbpaaabppbp |
Pattern: | [DEQ] | [AG] | [EK] | [KT] | [FLY] | [PR] | [F] | [NS] | [PV] | [F] | [D] | [L] | [T] | [K] | [TV] | [IW] | [PS] | [HQ] | [GK] | [DQ] | [FY] | [P] | x | x | [KPR] | [V] | [G] | [KT] | [IL] | [TV] | [L] | [N] | [ER] |
Conservation: | -0.471 | -0.633 | -0.197 | -0.825 | -0.674 | -0.688 | 1.564 | -0.129 | -0.809 | 1.564 | 1.564 | 0.343 | 0.954 | 0.954 | -0.735 | -0.235 | -0.495 | -0.220 | -1.016 | -0.320 | 0.883 | 2.174 | -1.326 | -1.627 | -1.081 | 0.343 | 1.564 | -0.818 | -0.250 | -0.735 | 0.343 | 1.564 | -0.529 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1a4e_A_283 | 1a4e | A | 285 | 317 | DAKKLPFSVFDLTKVWPQGQFPLRRVGKIVLNE | HHHTSSS-TT-TT----TTTS--EEEEEEEEEE | aaaaxabxaaxaabbxpaaabxxxxabbbbbab |
1dgf_A_286 | 1dgf | A | 288 | 320 | QAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNR | HHHH-SS-TT-TT----TTTS--EEEEEEEEEE | aaaapabxaaxaabbbpaaabxxbxabbbbbab |
1gwe_A_273 | 1gwe | A | 273 | 305 | EGKTYRFNPFDLTKTISQKDYPRIKVGTLTLNR | HHHH-SS-TT-TT----TTTS--EEEEEEEEEE | aaaaxabxaabaabxbxaaabxxbxaebxbxNb |
PDB ligands within a cut-off distance of 6 Å in this subclass |
PDB Site Annotated loops in this subclass |
Loop | PDB | Chain | Site | Residue |
1gwe_A_273 | 1gwe | A | AC2SO4 BINDING SITE FOR CHAIN A | R - 295 |
Clusters included in this Subclass |
CLUSTER: HE.19.2 |