Information on SUBCLASS 2.1.31 |
Subclass Accession number: 2190
Subclass: 2.1.31 Type: HH alpha-alpha DB: ArchDB40 Image coordinates: Consensus coordinates: Conserved Annotation EC : 2.3 (>75 %) 2.3.1 (>75 %) 3.1 (>75 %) 3.1.4 (>75 %) 3.1.4.17 GO : GO:0008081 (>75 %) GO:0008415 (>75 %) GO:0016746 (>75 %) GO:0016747 (>75 %) GO:0016788 (>75 %) GO:0042578 (>75 %) SCOP : 48546 (>75 %) 48547 (>75 %) 48548 (>75 %) 51160 (>75 %) 51161 (>75 %) 51168 (>75 %) |
Number of loops: 3 Average sequence ID (%) : 23.9 +/- 17.8 Average RMSD (Å) : 0.600 +/- 0.265 Consensus geometry
|
Consensus Sequence: | hXKXXX |
(φψ)-conformation: | aappaa |
Pattern: | x | [HNT] | [DQ] | [KR] | x | x | [FV] | [CL] | [AQR] | x | [CLM] | [IMV] | [HKT] | [ACL] | [AC] | [D] | [IL] | [NS] | [AGN] | [IP] | [AT] | [K] | [PSV] | x | [DEP] | [IL] | [HQY] | x | [KQR] | [LW] | [AT] | [DE] | x | [IV] | [AMV] | [ENT] | [E] | [F] | [FY] |
Conservation: | -1.103 | -0.364 | 0.416 | 0.774 | -1.251 | -0.687 | -0.329 | -0.063 | -0.733 | -1.103 | -0.290 | 0.079 | -0.881 | -0.660 | 0.256 | 2.369 | 0.430 | 0.293 | -0.733 | -0.343 | 0.095 | 1.704 | -1.251 | -1.177 | -0.290 | 0.419 | 0.005 | -1.029 | 0.079 | 1.020 | 0.062 | 0.881 | -1.694 | 0.729 | -0.660 | -0.586 | 1.704 | 2.369 | 1.539 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1f0j_A_377 | 1f0j | A | 377 | 415 | YTDRIQVLRNMVHCADLSNPTKSLELYRQWTDRIMEEFF | HHHHHHHHHHHHHHHHT-GGGS-HHHHHHHHHHHHHHHH | aaaaaaaaaaaaaaaaaaaaaxpaaaaaaaaaaaaaaaa |
1rkp_A_749 | 1rkp | A | 749 | 787 | PHQKELFLAMLMTACDLSAITKPWPIQQRLAELVATEFF | HHHHHHHHHHHHHHHHTGGGGS-HHHHHHHHHHHHHHHH | aaaaaaaaaaaaaaaaaaaaaxwaaaaaaaaaaaaaaaa |
1so2_A_922 | 1so2 | A | 922 | 960 | ENDRLLVCQVCIKLADINGPAKVRDLHLKWTEGIVNEFY | HHHHHHHHHHHHHHHHT-GGGS-HHHHHHHHHHHHHHHH | aaaaaaaaaaaaaaaaaaaaabpaaaaaaaaaaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Clusters included in this Subclass |
CLUSTER: HH.6.153 |