ArchDB - Biological DataBase of Protein Loops

Information on SUBCLASS 12.7.1

Subclass Accession number: 4288
Subclass: 12.7.1

Type: AR beta-beta link
DB: ArchDB95

Image coordinates:

Consensus coordinates:

Conserved Annotation
EC : 5.2 (>75 %)  5.2.1 (>75 %)  5.2.1.8
GO : GO:0003755 (>75 %)  GO:0005201 (>75 %)  GO:0016853 (>75 %)  GO:0016859 (>75 %)
SCOP : 50890 (>75 %)  50891 (>75 %)  50892 (>75 %)  56435 (>75 %)  56436 (>75 %)  75585 (>75 %)

Number of loops: 4

Average sequence ID (%) : 48.9 +/- 20.4
Average RMSD (Å) : 0.400 +/- 0.163

Consensus geometry

d (Å): 7

delta (°): 135-180

theta (°): 45-90

rho (°): 225-270

Consensus Sequence:	XHSQTXpXPXCPXGXp
(φψ)-conformation:	bbalbappppppplbb

Pattern:	[ALV]	[ILMV]	[ATV]	x	[H]	[S]	[Q]	[DT]	x	[DQS]	x	[P]	x	[C]	[P]	[ASV]	[G]	x	[KNRS]	x	[L]	[WY]	x	[G]	[Y]	[S]	[FL]	[LV]	[MY]	[FHV]	[EQT]
Conservation:	-0.731	-0.371	-0.708	-0.994	1.841	0.285	0.674	-0.317	-0.848	-0.589	-1.051	1.452	-1.003	2.229	1.452	-0.821	1.063	-0.600	-0.687	-1.108	0.285	1.220	-1.136	1.063	1.452	0.285	-0.321	-0.223	-0.263	-0.873	-0.655

Loops included in this Subclass

Loop	PDB	Chain	Start	End	Sequence	Sec Struct	Ramachandran
1li1_A_117	1li1	A	117	147	VMAVHSQTIQIPPCPSGWSSLWIGYSFVMHT	EEEEE-SSSS-----TTEEEEEEEEEEEEEE	bbbbbavbaxxxxxppvbbxabbbbxxabbb
1li1_A_6	1li1	A	7	37	LVTRHSQTIDDPQCPSGTKILYHGYSLLYVQ	EEEEE-SSSS-----TT-EEEEEEEEEEEEE	bbbbbavbaxxxxxxpvbbxabbbbxxabbb
1li1_C_117	1li1	C	117	147	AIAVHSQDVSIPHCPAGWRSLWIGYSFLMHT	EEEEE-SSSS-----TTEEEEEEEEEEEEEE	bbbbbalbaxxxxxxpvbbxabbbbxxabbb
1li1_C_6	1li1	C	7	37	LLVKHSQTDQEPMCPVGMNKLWSGYSLLYFE	EEEEE-SSSS-----TT-EEEEEEEEEEEEE	bxbbbavbabxxxxppvxxxabbbbxxabbb

PDB ligands within a cut-off distance of 6 Å in this subclass

Loop	PDB	Chain	Ligands	Residue
1li1_A_6	1li1	A	ACTACETATE ION	Y - 31

Clusters included in this Subclass