ArchDB - Biological DataBase of Protein Loops

Information on SUBCLASS 5.42.1

Subclass Accession number: 4934
Subclass: 5.42.1

Type: HH alpha-alpha
DB: ArchDB95

Image coordinates:

Consensus coordinates:

Conserved Annotation
GO : GO:0003700 (>75 %)
SCOP : 46688 (>75 %) 46689 (>75 %) 46690 (>75 %)

Number of loops: 2

Average sequence ID (%) : 100.0 +/- 0.0
Average RMSD (Å) : 0.300 +/- 0.000

Consensus geometry

d (Å): 15

delta (°): 90-135

theta (°): 135-180

rho (°): 270-315

Consensus Sequence:	IENPYLDTK
(φψ)-conformation:	aabapppaa

Pattern:	x	x	x	x	x	x	x	x	x	x	x	x	x	x	x	x	x	x	x	x	x	x	x	x	x	x	x	x	x	x	x	x
Conservation:	-0.205	-0.205	0.523	-0.933	-0.205	-0.933	-0.933	-0.205	-0.933	4.164	0.523	-0.933	-0.205	0.523	-0.933	-0.205	0.523	1.252	1.252	-0.933	0.523	-0.205	-0.205	0.523	-0.933	-0.205	0.523	-0.933	-0.205	-0.205	0.523	-0.205

Loops included in this Subclass

Loop	PDB	Chain	Start	End	Sequence	Sec Struct	Ramachandran
1le8_B_138	1le8	B	138	169	KENVRILESWFAKNIENPYLDTKGLENLMKNT	HHHHHHHHHHHHHTSSS----HHHHHHHHHHH	aaaaaaaaaaaaaaaababxxaaaaaaaaaaa
1mnm_C_138	1mnm	C	138	169	KENVRILESWFAKNIENPYLDTKGLENLMKNT	HHHHHHHHHHHHHTTSS----HHHHHHHHHHH	aaaaaaaaaaaaaaaabaxxbaaaaaaaaaaa

Clusters included in this Subclass