|
|
|
|
|
|
|
| Information on CLUSTER HH.21.2 |
Subclass Accession number: HH-22.1.1
DB: ArchDB-EC
| Loops included in this Cluster |
| Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
| 1frf_S_227 | 1frf | S | 227 | 256 | CPKVLFNQVNWPVQAGHPCLGCSEPDFWDT | HHHH-BTTTB-GGGGT-----TTSTTHHHH | aaaaebvvNbbaaaavbxxavaabplaaaa |
| 1ubk_S_231 | 1ubk | S | 231 | 260 | CPKIKFNQTNWPVDAGHPCIGCSEPDFWDA | HHHH-BTTTB-TGGGT-----TTSTTHHHH | aaaaeblvNbbaaaavbxxavaabxlaaaa |
| 2frv_A_228 | 2frv | A | 228 | 257 | CPKQLFNQVNWPVQAGHPCIACSEPNFWDL | HHHH-BTTTB-GGGGT-----TTSTTHHHH | aaaaeblvabbaaaavbxxalaabplaaaa |
| For any comment or web-related incidence, send an email to the webmaster. |
|