ArchDB - Biological DataBase of Protein Loops

Information on SUBCLASS 9.25.1

Subclass Accession number: 5093
Subclass: 9.25.1

Type: HH alpha-alpha
DB: ArchDB95

Image coordinates:

Consensus coordinates:

Conserved Annotation
EC : 2.7 (>50 %)  2.7.7 (>50 %)  2.7.7.7
GO : GO:0003887 (>75 %)  GO:0004518 (>75 %)  GO:0004527 (>75 %)  GO:0016772 (>75 %)  GO:0016779 (>75 %)  GO:0016788 (>75 %)
SCOP : 56671 (>75 %)  56672 (>75 %)  56673 (>75 %)

Number of loops: 3

Average sequence ID (%) : 93.5 +/- -82.3
Average RMSD (Å) : 0.333 +/- 0.058

Consensus geometry

d (Å): 29

delta (°): 90-135

theta (°): 90-135

rho (°): 315-360

Consensus Sequence:	pRNphAPNKPDER
(φψ)-conformation:	aalppppppppaa

Pattern:	[T]	[G]	[N]	[L]	[V]	[E]	[W]	[F]	[L]	[L]	[R]	[K]	[A]	[Y]	[EK]	[R]	[N]	[DE]	[LV]	[A]	[P]	[N]	[K]	[P]	[D]	[E]	[R]	[E]	[L]	[A]	[R]
Conservation:	-0.088	0.552	0.552	-0.728	-0.728	-0.088	3.752	0.552	-0.728	-0.728	-0.088	-0.088	-0.728	1.192	-1.366	-0.088	0.552	-0.893	-1.687	-0.728	1.192	0.552	-0.088	1.192	0.552	-0.088	-0.088	-0.088	-0.728	-0.728	-0.088

Loops included in this Subclass

Loop	PDB	Chain	Start	End	Sequence	Sec Struct	Ramachandran
1d5a_A_349	1d5a	A	349	379	TGNLVEWFLLRKAYERNDVAPNKPDERELAR	HHHHHHHHHHHHHHHTTB-------HHHHHH	aaaaaaaaaaaaaaaavxxxwxxxxaaaaaa
1qht_A_349	1qht	A	349	379	TGNLVEWFLLRKAYKRNELAPNKPDERELAR	HHHHHHHHHHHHHHHTTB-------HHHHHH	aaaaaaaaaaaaaaaalxpxxxxxxaaaaaa
1tgo_A_349	1tgo	A	349	379	TGNLVEWFLLRKAYERNELAPNKPDERELAR	HHHHHHHHHHHHHHHTTB-------HHHHHH	aaaaaaaaaaaaaaaalbxxxxxxxaaaaaa

Clusters included in this Subclass